PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca45711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 579aa    MW: 65043.9 Da    PI: 4.6083
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca45711.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-53221482128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                 ppGfrFhPtdeelv +yLk+k+ +++l+l +vi+evd+yk+eP++Lp  + +k+++++w+fFs+rd+ky++++r+nrat++gyWkatgkd+++++ +++
  Dca45711.1  22 PPGFRFHPTDEELVLYYLKRKICRRRLKL-DVIAEVDVYKWEPEELPgmALLKNGDRQWFFFSPRDRKYPNSSRANRATRQGYWKATGKDRTITC-NSR 118
                 8****************************.99***************6447788999**************************************.999 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 +vg+kktLvfy+grap+g++tdWvmhey l
  Dca45711.1 119 DVGIKKTLVFYRGRAPSGQRTDWVMHEYVL 148
                 ****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6017171IPR003441NAC domain
PROSITE profilePS5100555.06621171IPR003441NAC domain
PfamPF023651.0E-2722148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MNSTTTSTTN SSPANLCDDE WPPGFRFHPT DEELVLYYLK RKICRRRLKL DVIAEVDVYK  60
WEPEELPGMA LLKNGDRQWF FFSPRDRKYP NSSRANRATR QGYWKATGKD RTITCNSRDV  120
GIKKTLVFYR GRAPSGQRTD WVMHEYVLEE DELKRCQNVH DHYAIYKMFK KSGPGPKNGE  180
QYGAPFREEE WPEDDFRKNS SDRNLVSIDQ QVNNVSPVET CTDAQVDVSK TSVDVLLNGV  240
PDDHAPWPVN LDDFEEALTQ LQNAEETRKS FNAVAGDSAY YEPKMTHTSV PQQDYLNSSF  300
SAGQSRDATE VSSATNSDFF AWPEFAERQL SVDDFLEMDD LVGPEPAQVS DFQAQPTINT  360
YDNGQVIDDD DGFDLYRDAD LLLGDLDPNN QISSPIQYPM SLQDGFIEQV DLYQENVPNF  420
GDESWNYDAN SFFHNSTEAS QFTMPLQPPG VVHTGVPESL PNNSTQNQNE KHTQQSQAWL  480
SSALWSFVES IPAAPASAAE SALVNKALKR MSSLRRVRLT PRSAVSGTVS AVESASAGVG  540
RRVKGFSTLS ILAVLFAVLC VFIGSHSSIF GKLNCHMNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-492214816140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010696509.10.0PREDICTED: NAC domain-containing protein 74-like
TrEMBLA0A0J8BA160.0A0A0J8BA16_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.14e-96NAC domain containing protein 17